PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v0050650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 406aa    MW: 46101.6 Da    PI: 7.3181
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v0050650.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.37.7e-50331582128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                      +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + ++
  Lj4g3v0050650.1  33 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTE 125
                      79***************************.89***************8778899**************************************** PP

              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + + +glkktLvfy+g+apkg +t+W+m+eyrl
  Lj4g3v0050650.1 126 NFRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 158
                      *******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-5532178IPR003441NAC domain
PROSITE profilePS5100555.80432179IPR003441NAC domain
PfamPF023654.1E-2534158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MSHEDGTTTT TTSSANENSN KQLLDDHEND TVMPGFRFHP TEEELVEFYL RRKVEGKRFN  60
VELITFLDLY RYDPWELPAL AAIGEKEWYF YVPRDRKYRN GDRPNRVTTS GYWKATGADR  120
MIRTENFRSI GLKKTLVFYS GKAPKGIRTS WIMNEYRLPQ HETERYQKAE ISLCRVYKRA  180
GVEDHPSLPR CLPITKQPSS SRSSKPSEIA QHQYLPHNMG LFLGQSNSKP VHDGQIVENH  240
ETEGISSTGS GSGSEHHVTT ALGLSKYNAY RAAVGSLSNT NTIGLPAEEE GLMLLPQHHQ  300
SNNPKQPPNN SLVHACFPAN AVPSNNNNNN VVMMDDLNRL VSYQPQFFNV QSHPNHQLSA  360
LLMQTAPPMS LNSLPNTLPT TFSDRLWDWN PIPEVNQDHP NIMPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-553417919165NAC domain-containing protein 19
4dul_A2e-553417919165NAC domain-containing protein 19
1ut7_B2e-553417919165NO APICAL MERISTEM PROTEIN
1ut7_A2e-553417919165NO APICAL MERISTEM PROTEIN
1ut4_B2e-553417919165NO APICAL MERISTEM PROTEIN
1ut4_A2e-553417919165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163863.10.0hypothetical protein PHAVU_L010000g
TrEMBLV7D0B90.0V7D0B9_PHAVU; Uncharacterized protein
STRINGGLYMA17G00650.21e-180(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-110NAC domain containing protein 35